PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02632g07001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 256aa    MW: 28138.3 Da    PI: 8.9425
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02632g07001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.23.6e-382887261
                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              + +al+cprCds ntkfCyynny+lsqPr+fC++CrryWtkGG lrnvPvGgg+rk+k+s
  Niben101Scf02632g07001.1 28 QPQALNCPRCDSLNTKFCYYNNYNLSQPRHFCQSCRRYWTKGGILRNVPVGGGCRKSKRS 87
                              56899****************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-242681IPR003851Zinc finger, Dof-type
PfamPF027016.6E-333086IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1613286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MQDIYSIGGG GGRFYGGSGS DRRLRLNQPQ ALNCPRCDSL NTKFCYYNNY NLSQPRHFCQ  60
SCRRYWTKGG ILRNVPVGGG CRKSKRSKPK PSAVSTTDNT CQENKSNSNS NSGSESCSLT  120
AITSTATAAN TSIAMTPEVV LGNSSNPTLP DVQYSRFLVT ETTKGDFIDQ QVVGRHTTEE  180
QIFRDIGASP INVNNISMYQ NSNVCFFDRT AHVELSGRRA NDGGLAPVDW QTRGLFGMME  240
NSDHRYALSL KLSLTN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009786397.11e-120PREDICTED: dof zinc finger protein DOF5.4-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1695345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-32OBF binding protein 4